PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7663_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 1166aa    MW: 126608 Da    PI: 6.1564
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7663_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.11.1e-09823864346
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                          +WT+eE e++ d  + +G++ +k+Ia+ +  ++t  +c+++++k
  cra_locus_7663_iso_2_len_3810_ver_3 823 PWTAEEKEIFMDKLATYGKD-FKKIASFLM-HKTTADCVEFYYK 864
                                          8*****************99.*********.***********98 PP

2Myb_DNA-binding331.4e-1010421082345
                                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                      Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                                            WT eE  ++v+av  +G++ ++ I+r++  +R++ qc+ ++ 
  cra_locus_7663_iso_2_len_3810_ver_3 1042 DWTDEEKSIFVQAVSSYGKD-FTMISRCIR-TRSRDQCRVFFS 1082
                                           5*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-14806868IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-6816867IPR009057Homeodomain-like
PROSITE profilePS5129316.425819870IPR017884SANT domain
SMARTSM007171.9E-8820868IPR001005SANT/Myb domain
PfamPF002495.6E-7822864IPR001005SANT/Myb domain
PROSITE profilePS5129310.71310381089IPR017884SANT domain
SMARTSM007171.5E-810391087IPR001005SANT/Myb domain
SuperFamilySSF466891.01E-1010401089IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-610421083IPR009057Homeodomain-like
PfamPF002495.7E-810421082IPR001005SANT/Myb domain
CDDcd001672.49E-710431081No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1166 aa     Download sequence    Send to blast
MPPEPLPWDR KDFFKERKHE RSEQHHPPHP HPHQIGGGGG FGGVGGFGGG PRWREPLHPH  60
PHPYHYASPR WASSDFRYRP PHGYGKHSGR NPYPEETSHG FMSSRPNDKT LDDESYRASG  120
SGKYSRNNRE SRSSFSQKDW KGHTWEATPS PNGPGRPNDV SDQPRSVDDM HTCNSSNPHS  180
DSANSWDQPQ SKDQHEKNGG VNATASSGPR FERESSLGSW KPLNKWTRSG SLSSRGSGFS  240
HSSSSKSMGA DSSEMKVEVQ PINVTPINSP SGDAAPAAAC EMYVAPSEET NSRKKPRLGW  300
GEGLAKYEKK KVVCVDDTAA AKNGVVICSS NREPVNLLSS SLADKSPGVT GFSDCASPAT  360
PSSVGCSSSP GMEEKQFVKA GTVEQETTNS MVSPGIVSQT RLEDSSFNLE NLDLAPITSL  420
NSAINELLQV DDLSSVDSGF VKSTAISKLL VWKGDVLKAL ELTESEIDKL EGELKLISEP  480
GTSGVHPVAS TSLALDCHPK PADDQDAASD ITPGQSPLEL VSSGGNDVGE MQHTMEVDHA  540
EAKDDNVDSP GSATSKFVEI PTSGKDVSVT QLGGQRTQSK GFEDLGVKCS ECTLNEDKGA  600
EVYASCDGSN LVADGSSTHA DDFSLLCDYD NKLCESILAS NREIANRAAE VFNKLLPPNQ  660
SFFDISSAAG VSCPESTPLI KERLMRRKSS LRLKERVISL KFRALHHLWK DDIRSLSIRK  720
FRVKSQKKFD LSVRAVNGSN QKHRLSIRRL SSAGSLNLTA TPETTDFLSK LISDSQFKPL  780
RNTLKMPALI LDEREKMVSR FISTNGLVED PCGVEKERSM INPWTAEEKE IFMDKLATYG  840
KDFKKIASFL MHKTTADCVE FYYKNHKSDC FKQTKEHSGF VKQGKAQSTN NYLVASGKRW  900
NRECNAASLD ILGAASAIAA NIEVGMEIQQ KCSSKYLAGL SSNCQTSRGN VAVLERSSSL  960
DGDNTDKETV AADVLAGICG SLSSEAMGSC ITSAVDPGEG YHEWKCQKVG STSRWPPTPE  1020
VTQSIDDETC SDESCGEMDP TDWTDEEKSI FVQAVSSYGK DFTMISRCIR TRSRDQCRVF  1080
FSKARKCLGL DMICPGSGNT DVVRNEANGA GSETDDACVV EAVSHMCSVK SGVGTEDLPS  1140
PDVKLNKEPD CVVEAVSHMC SVKSGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-16780872394NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-16780872394NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010658422.10.0PREDICTED: uncharacterized protein LOC100240985 isoform X1
TrEMBLA0A068TU320.0A0A068TU32_COFCA; Uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)